Saturday, November 1, 2025
  • Login
Radio SAI 100FM
  • BERANDA
  • HIBURAN
  • MUSIK
  • FILM
  • K-POP
  • GAYA HIDUP
  • KESEHATAN
  • SOSOK
  • TEKNOLOGI
  • NEWS
  • PROFIL
  • HUBUNGI KAMI
No Result
View All Result
Radio SAI 100FM
  • BERANDA
  • HIBURAN
  • MUSIK
  • FILM
  • K-POP
  • GAYA HIDUP
  • KESEHATAN
  • SOSOK
  • TEKNOLOGI
  • NEWS
  • PROFIL
  • HUBUNGI KAMI
No Result
View All Result
Radio SAI 100FM
No Result
View All Result
Home Hiburan

Cari Tau Daftar Lengkap Nominasi Grammy Awards 2020

Billie Eilish, Masuk Dalam Kategori Best New Artist Tahun Ini

adminsaibyadminsai
November 22, 2019
in Hiburan
Share on FacebookShare on Twitter
ADVERTISEMENT

sai100fm.id – Grammy Awards 2020 akan segera digelar, tepatnya pada 26 Januari 2020 dengan penyanyi Alicia Keys sebagai pembawa acaranya.

Nominasinya tahun ini terdapat 84 kategori yang akan diperebutkan pada Grammy Awards ke-62 tersebut.

Kategori tersebut mencakup beragam aliran musik populer hingga yang kerap tidak mendapat perhatian di penghargaan utama. Rencananya, ajang penghargaan yang diberikan National Academy of Recording Arts and Sciences di Amerika Serikat ini akan diselenggarakan di Madison Square Garden, New York.

ADVERTISEMENT

Melansir dari grammy.com, berikut nominasi lengkap Grammy Awards 2020:

Record of the Year
Hey, Ma — Bon Iver
Bad Guy — Billie Eilish
7 Rings — Ariana Grande
Hard Place — H.E.R.
Talk — Khalid
Old Town Road — Lil Nas X Featuring Billy Ray Cyrus
Truth Hurts — Lizzo
Sunflower — Post Malone & Swae Lee

Album of the Year
I, I — Bon Iver
Norman F—ing Rockwell! — Lana Del Rey
When We All Fall Asleep, Where Do We Go? — Billie Eilish
Thank U, Next — Ariana Grande
I Used To Know Her — H.E.R.
7 — Lil Nas X
Cuz I Love You (Deluxe) — Lizzo
Father of the Bride — Vampire Weekend

Song of the Year
Always Remember Us This Way — Natalie Hemby, Lady Gaga, Hillary Lindsey & Lori McKenna, songwriters (Lady Gaga)
Bad Guy — Billie Eilish O’Connell & Finneas O’Connell, songwriters (Billie Eilish)
Bring My Flowers Now — Brandi Carlile, Phil Hanseroth, Tim Hanseroth & Tanya Tucker, songwriters (Tanya Tucker)
Hard Place — Ruby Amanfu, Sam Ashworth, D. Arcelious Harris. H.E.R. & Rodney Jerkins, songwriters (H.E.R.)
Lover — Taylor Swift, songwriter (Taylor Swift)
Norman F—ing Rockwell — Jack Antonoff & Lana Del Rey, songwriters (Lana Del Rey)
Someone You Loved — Tom Barnes, Lewis Capaldi, Pere Kelleher, Benjamin Kohn & Sam Roman, songwriters (Lewis Capaldi)
Truth Hurts — Steven Cheung, Eric Frederic, Melissa Jefferson & Jesse Saint John, songwriters (Lizzo)

Best New Artist
Black Pumas
Billie Eilish
Lil Nas X
Lizzo
Maggie Rogers
Rosalía
Tank and the Bangas
Yola

POP FIELD

Best Pop Solo Performance
“Spirit” — Beyoncé
“Bad Guy” — Billie Eilish
“7 Rings” — Ariana Grande
“Truth Hurts” — Lizzo
“You Need To Calm Down” — Taylor Swift

Best Pop Duo/Group Performance
“Boyfriend” — Ariana Grande & Social House
“Sucker” — Jonas Brothers
“Old Town Road” — Lil Nas X & Billy Ray Cyrus
“Señorita” — Shawn Mendes & Camila Cabello

Best Traditional Pop Vocal Album
Sì — Andrea Bocelli
Love (Deluxe Edition) — Michael Bublé
Look Now — Elvis Costello & The Imposters
A Legendary Christmas — John Legend
Walls — Barbra Streisand

Best Pop Vocal Album

The Lion King: The Gift — Beyoncé
When We All Fall Asleep, Where Do We Go — Billie Eilish
Thank U, Next — Ariana Grande
No. 6 Collaborations Project — Ed Sheeran
Lover — Taylor Swift

DANCE/ELECTRONIC FIELD

Best Dance Recording:

“Linked” — Bonobo
“Got To Keep On” — The Chemical Brothers
“Piece Of Your Heart” — Meduza & Goodboys
“Underwater” — Rüfüs Du Sol
“Midnight Hour” — Skrillex & Boys Noize With Ty Dolla $ign

Best Dance/Electronic Album:

LP5 — Apparat
No Geography — The Chemical Brothers
Hi This Is Flume (Mixtape) — Flume
Solace — Rüfüs Du Sol
Weather — Tycho

CONTEMPORARY INSTRUMENTAL MUSIC

Best Contemporary Instrumental Album:

Ancestral Recall — Christian Scott aTunde Adjuah
Star People Nation — Theo Croker
Beat Music! Beat Music! Beat Music! — Mark Guiliana
Elevate — Lettuce
Mettavolution — Rodrigo y Gabriela

ROCK

Best Rock Performance:

“Pretty Waste” — Bones UK
“This Land” — Gary Clark Jr.
“History Repeats” — Brittany Howard
“Woman” — Karen O & Danger Mouse
“Too Bad” — Rival Sons

Best Metal Performance:

“Astorolus – The Great Octopus” — Candlemass ft. Tony Iommi
“Humanicide” — Death Angel
“Bow Down” — I Prevail
“Unleashed” — Killswitch Engage
“7empest” — Tool

Best Rock Song:

“Fear Inoculum” — Danny Carey, Justin Chancellor, Adam Jones & Maynard James Keenan, Songwriters (Tool)
“Give Yourself A Try” — George Daniel, Adam Hann, Matthew Healy & Ross Macdonald, Songwriters (The 1975)
“Harmony Hall” — Ezra Koenig, Songwriter (Vampire Weekend)
“History Repeats” — Brittany Howard, Songwriter (Brittany Howard)
“This Land” — Gary Clark Jr., Songwriter (Gary Clark Jr.)

Best Rock Album:

Amo — Bring Me The Horizon
Social Cues — Cage The Elephant
In The End — The Cranberries
Trauma — I Prevail
Feral Roots — Rival Sons

ALTERNATIVE

Best Alternative Music Album:

U.F.O.F. — Big Theif
Assume Form — James Blake
i,i — Bon Iver
Father of the Bride — Vampire Weekend
Anima — Thom Yorke

R&B

Best R&B Performance:

“Love Again” — Daniel Caesar & Brandy
“Could’ve Been” — H.E.R. & Bryson Tiller
“Exactly How I Feel” — Lizzo & Gucci Mane
“Roll Some Mo” — Lucky Daye
“Come Home” — Anderson .Paak & André 300

Best Traditional R&B Performance:

“Time Today” — BJ The Chicago Kid
“Steady Love” — India.Arie
“Jerome” — Lizzo
“Real Games” — Lucky Daye
“Built For Love” — PJ Morton & Jazmine Sullivan

Best R&B Song:

“Could’ve Been” — Dernst Emile Ii, David “Swagg R’celious” Harris, H.E.R. & Hue “Soundzfire” Strother, Songwriters (H.E.R. Ft. Bryson Tiller)
“Look At Me Now” — Emily King & Jeremy Most, Songwriters (Emily King)
“No Guidance” — Chris Brown, Tyler James Bryant, Nija Charles, Aubrey Graham, Anderson Hernandez, Michee Patrick Lebrun, Joshua Lewis, Noah Shebib & Teddy Walton, Songwriters (Chris Brown Ft. Drake)
“Roll Some Mo” — David Brown, Dernst Emile Ii & Peter Lee Johnson, Songwriters (Lucky Daye)
“Say So” — Pj Morton, Songwriter (Pj Morton Ft. Jojo)

Best Urban Contemporary Album:

Apollo XXI — Steve Lacy
Cuz I Love You (Deluxe) — Lizzo
Overload — Georgia Anne Muldrow
Saturn — Nao
Being Human In Public — Jessie Reyez

Best R&B Album:

1123 — BJ The Chicago Kid
Painted — Lucky Daye
Ella Mai — Ella Mai
Paul — PJ Morton
Venture — Anderson .Paak

RAP

Best Rap Performance:

“Middle Child” — J.Cole
“Suge” — DaBaby
“Down Bad” — Dreamville ft. J.I.D, Bas, J. Cole, Earthgang & Young Nudy
“Racks In The Middle” — Nipsey Hussle ft. Roddy Ricch & Hit-boy
“Clout” — Offset ft. Cardi B

Best Rap/Sung Performance:

“Higher” — DJ Khaled ft. Nipsey Hussle & John Legend
“Drip Too Hard” — Lil Baby & Funna
“Panini” — Lil Nas X
“Ballin” — Mustard ft. Roddy Ricch
“The London” — Young Thug ft. J. Cole & Travis Scott

Best Rap Song:

“Bad Idea” — Chancelor Bennett, Cordae Dunston, Uforo Ebong & Daniel Hackett, songwriters (Ybn Cordae ft. Chance The Rapper)
“Gold Roses” — Noel Cadastre, Aubrey Graham, Anderson Hernandez, Khristopher Riddick-tynes, William Leonard Roberts Ii, Joshua Quinton Scruggs, Leon Thomas Iii & Ozan Yildirim, songwriters (Rick Ross ft. Drake)
“A Lot” — Jermaine Cole, Dacoury Natche, 21 Savage & Anthony White, songwriters (21 Savage ft. J. Cole)
“Racks In The Middle” — Ermias Asghedom, Dustin James Corbett, Greg Allen Davis, Chauncey Hollis, Jr. & Rodrick Moore, songwriters (Nipsey Hussle ft. Roddy Ricch & Hit-boy)
“Suge” — Dababy, Jetsonmade & Pooh Beatz, songwriters (Dababy)

Best Rap Album:

Revenge Of The Dreamers III — Dreamville
Championships — Meek Mill
i am > i was — 21 Savage
IGOR — Tyler, The Creator
The Lost Boy — YBN Cordae

COUNTRY

Best Country Solo Performance:

“All Your’n” — Tyler Childers
“Girl Goin’ Nowhere” — Ashley McBryde
“Ride Me Back Home” — Willie Nelson
“God’s Country” — Blake Shelton
“Bring My Flowers Now” — Tanya Tucker

Best Country Duo/Group Performance:

“Brand New Man” — Brooks & Dunn with Luke Combs
“I Don’t Remember Me (Before You)” — Brothers Osborne
“Speechless” — Dan & Shay
“The Daughters” — Little Big Town
“Common” — Maren Morris ft. Brandi Carlile

Best Country Song:

“Bring My Flowers Now” — Brandi Carlile, Phil Hanseroth, Tim Hanseroth & Tanya Tucker, Songwriters (Tanya Tucker)
“Girl Goin’ Nowhere” — Jeremy Bussey & Ashley Mcbryde, Songwriters (Ashley Mcbryde)
“It All Comes Out In The Wash” — Miranda Lambert, Hillary Lindsey, Lori Mckenna & Liz Rose, Songwriters (Miranda Lambert)
“Some Of It” — Eric Church, Clint Daniels, Jeff Hyde & Bobby Pinson, Songwriters (Eric Church)
“Speechless” — Shay Mooney, Jordan Reynolds, Dan Smyers & Laura Veltz, Songwriters (Dan + Shay)

Best Country Album:

Desperate Man — Eric Church
Stronger Than The Truth — Reba McEntire
Interstate Gospel — Pistol Annies
Center Point Road — Thomas Rhett
While I’m Livin’ — Tanya Tucker

NEW AGE

Best New Age Album:

Fairy Dreams — David Arkenstone
Homage To Kindness — David Darling
Wings — Peter Kater
Verve — Sebastian Plano
Deva — Deva Premal

JAZZ

Best Improvised Jazz Solo:

“Elsewhere” — Melissa Aldana, soloist
“Sozinho” — Randy Brecker, soloist
“Tomorrow Is The Question” — Julian Lage, soloist
“The Windup” — Brandford Marsalis, soloist
“Sightseeing” — Christian McBride, soloist

Best Jazz Vocal Album:

Thirsty Ghost — Sara Gazarek
Love & Liberation — Jazzmeia Horn
Alone Together — Catherine Russell
12 Little Spells — Esperanza Spalding
Screenplay — The Tierney Sutton Band

Best Jazz Instrumental Album:

In The Key Of The Universe — Joey DeFrancesco
The Secret Between The Shadow And The Soul — Branford Marsalis Quartet
Christian McBride’s New Jawn — Brad Mehldau
Come What May – Joshua Redman Quartet

Best Jazz Ensemble Album:

Triple Helix — Anat Cohen Tentet
Dancer In Nowhere — Miho Hazama
Hiding Out — Mike Holober & The Gotham Jazz Orchestra
The Omni-american Book Club — Brian Lynch Big Band
One Day Wonder — Terraza Big Band

Best Latin Jazz Album:

Antidote — Chick Corea & The Spanish Heart Band
Sorte!: Music By John Finbury — Thalma De Freitas With Vitor Gonçalves, John Patitucci, Chico Pinheiro, Rogerio Boccato & Duduka Da Fonseca
Una Noche Con Rubén Blades — Jazz At Lincoln Center Orchestra With Wynton Marsalis & Rubén Blades
Carib — David Sánchez
Sonero: The Music Of Ismael Rivera — Miguel Zenón

GOSPEL/CONTEMPORARY CHRISTIAN MUSIC

Best Gospel Performance/Song:

“Love Theory”– Kirk Franklin; Kirk Franklin, Songwriter
“Talkin’ ‘Bout Jesus” — Gloria Gaynor ft. Yolanda Adams; Bryan Fowler, Gloria Gaynor & Chris Stevens, Songwriters
“See The Light” — Travis Greene ft. Jekalyn Carr
“Speak The Name” — Koryn Hawthorne ft. Natalie Grant
“This Is A Move (Live)” — Tasha Cobbs Leonard; Tony Brown, Brandon Lake, Tasha Cobbs Leonard & Nate Moore, Songwriters

Best Contemporary Christian Music Performance/Song:

“Only Jesus” — Casting Crowns; Mark Hall, Bernie Herms & Matthew West, songwriters
“God Only Knows” — for King & Country & Dolly Parton; Josh Kerr, Jordan Reynolds, Joel Smallbone, Luke Smallbone & Tedd Tjornhom, songwriters
“Haven’t Seen It Yet” — Danny Gokey; Danny Gokey, Ethan Hulse & Colby Wedgeworth, songwriters
“God’s Not Done With You (Single Version)” — Tauren Wells
“Rescue Story” — Zach Williams; Ethan Hulse, Andrew Ripp, Jonathan Smith & Zach Williams, songwriters

Best Gospel Album:

Long Live Love — Kirk Franklin
Goshen — Donald Lawrence Presents The Tri-City Singers
Tunnel Vision — Gene Moore
Settle Here — William Murphy
Something’s Happening! A Christmas Album — CeCe Winans

Best Contemporary Christian Music Album:

I Know A Ghost — Crowder
Burn The Ships — for King & Country
Haven’t Seen It Yet — Danny Gokey
The Elements — TobyMac
Holy Roar — Chris Tomlin

Best Roots Gospel Album:

Deeper Roots: Where The Bluegrass
Grows — Steven Curtis Chapman
Testimony — Gloria Gaynor
Deeper Oceans — Joseph Habedank
His Name Is Jesus — Tim Menzies
Gonna Sing, Gonna Shout (Various Artists) — Jerry Salley, producer

LATIN

Best Latin Pop Album:

Vida — Luis Fonsi
11:11 — Maluma
Montaner — Ricardo Montaner
#ELDISCO — Alejandro Sanz
Fantasía — Sebastian Yatra

Best Latin Rock, Urban or Alternative Album:

X 100PRE — Bad Bunny
Oasis — J Balvin & Bad Bunny
Indestructible — Flor De Toloache
Almadura — iLe
El Mal Querer – Rosalía

Best Regional Mexican Music Album (Including Tejano):

Caminando — Joss Favela
Percepción — Intocable
Poco A Poco — La Energia Norteña
20 Aniversario — Mariachi Divas De Cindy Shea
De Ayer Para Siempre — Mariachi Los Camperos

Best Tropical Latin Album:

Opus — Marc Anthony
Tiempo Al Tiempo — Luis Enrique + C4 Trio
Candela — Vicente García
Literal — Juan Luis Guerra 4.40
A Journey Through Cuban Music — Aymée Nuviola

AMERICAN ROOTS MUSIC

Best American Roots Performance:

“Saint Honesty” — Sara Bareilles
“Father Mountain” — Calexico With Iron & Wine
“I’m On My Way” — Rhiannon Giddens With Francesco Turrisi
“Call My Name” — I’m With Her
“Faraway Look” — Yola

Best American Roots Song:

“Black Myself” — Amythyst Kiah, songwriter (Our Native Daughters)
“Call My Name” — Sarah Jarosz, Aoife O’donovan & Sara Watkins, songwriters (I’m With Her)
“Crossing To Jerusalem” — Rosanne Cash & John Leventhal, songwriters (Rosanne Cash)
“Faraway Look” — Dan Auerbach, Yola Carter & Pat Mclaughlin, songwriters (Yola)
“I Don’t Wanna Ride The Rails No More” — Vince Gill, songwriter (Vince Gill)

Best Americana Album:

Years To Burn — Calexico And Iron & Wine
Who Are You Now — Madison Cunningham
Oklahoma — Keb’ Mo’
Tales Of America — J.S. Ondara
Walk Through Fire — Yola

Best Bluegrass Album:

Tall Fiddler — Michael Cleveland
Live In Prague, Czech Republic — Doyle Lawson & Quicksilver
Toil, Tears & Trouble — The Po’ Ramblin’ Boys
Royal Traveller — Missy Raines
If You Can’t Stand The Heat — Frank Solivan & Dirty Kitchen

Best Traditional Blues Album:

Kingfish — Christone “Kingfish” Ingram
Tall, Dark & Handsome — Delbert McClinton & Self-made Men
Sitting On Top Of The Blues — Bobby Rush
Baby, Please Come Home — Jimmie Vaughan
Spectacular Class — Jontavious Willis

Best Contemporary Blues Album:

This Land — Gary Clark Jr.
Venom & Faith — Larkin Poe
Brighter Days — Robert Randolph & The Family Band
Somebody Save Me — Sugaray Rayford
Keep On — Southern Avenue

Best Folk Album:

My Finest Work Yet — Andrew Bird
Rearrange My Heart — Che Apalache
Patty Griffin — Patty Griffin
Evening Machines — Gregory Alan Isakov
Front Porch — Joy Williams

Best Regional Roots Music Album:

Kalawai’anui — Amy H?naiali’i
When It’s Cold – Cree Round Dance Songs — Northern Cree
Good Time — Ranky Tanky
Recorded Live At The 2019 New Orleans Jazz & Heritage Festival — Rebirth Brass Band
Hawaiian Lullaby (Various Artists) — Imua Garza & Kimié Miner, Producers

REGGAE

Best Reggae Album:

Rapture — Koffee
As I Am — Julian Marley
The Final Battle: Sly & Robbie Vs. Roots Radics — Sly & Robbie & Roots Radics
Mass Manipulation — Steel Pulse
More Work To Be Done — Third World

WORLD MUSIC

Best World Music Album:

Gece — Altin Gün
What Heat — Bokanté & Metropole Orkest Conducted By Jules Buckley
African Giant — Burna Boy
Fanm D’ayiti — Nathalie Joachim With Spektral Quartet
Celia — Angelique Kidjo

CHILDREN’S

Best Children’s Music Album:

Ageless Songs For The Child Archetype — Jon Samson
Flying High! — Caspar Babypants
I Love Rainy Days — Daniel Tashian
The Love — Alphabet Rockers
Winterland — The Okee Dokee Brothers

SPOKEN WORD

Best Spoken Word Album (Includes Poetry, Audio Books & Storytelling):

Beastie Boys Book (Various Artists) — Michael Diamond, Adam Horovitz, Scott Sherratt & Dan Zitt, producers
Becoming — Michelle Obama
I.V. Catatonia: 20 Years As A Two-Time Cancer Survivor — Eric Alexandrakis
Mr. Know-It-All — John Waters
Sekou Andrews & The String Theory — Sekou Andrews & The String Theory

Comedy

Best Comedy Album:

Quality Time — Jim Gaffigan
Relatable — Ellen Degeneres
Right Now — Aziz Ansari
Son Of Patricia — Trevor Noah
Sticks & Stones — Dave Chappelle

MUSICAL THEATER

Best Musical Theater Album:

Ain’t Too Proud: The Life And Times Of The Temptations — Saint Aubyn, Derrick Baskin, James Harkness, Jawan M. Jackson, Jeremy Pope & Ephraim Sykes, principal soloists; Scott M. Riesett, producer (Original Broadway Cast)
Hadestown — Reeve Carney, André De Shields, Amber Gray, Eva Noblezada & Patrick Page, principal soloists; Mara Isaacs, David Lai, Anaïs Mitchell & Todd Sickafoose, producers (Anaïs Mitchell, composer & lyricist) (Original Broadway Cast)
Moulin Rouge! The Musical — Danny Burstein, Tam Mutu, Sahr Ngaujah, Karen Olivo & Aaron Tveit, principal soloists; Justin Levine, Baz Luhrmann, Matt Stine & Alex Timbers, producers (Original Broadway Cast)
The Music Of Harry Potter And The Cursed Child – In Four Contemporary Suites — Imogen Heap, producer; Imogen Heap, composer (Imogen Heap)
Oklahoma! — Damon Daunno, Rebecca Naomi Jones, Ali Stroker, Mary Testa & Patrick Vaill, principal soloists; Daniel Kluger & Dean Sharenow, producers (Richard Rodgers, composer; Oscar Hammerstein II, lyricist) (2019 Broadway Cast)

MUSIC FOR VISUAL MEDIA

Best Compilation Soundtrack For Visual Media:

The Lion King: The Songs — (Various Artists)
Quentin Tarantino’s Once Upon A Time In Hollywood — (Various Artists)
Rocketman — Taron Egerton
Spider-Man: Into The Spider-Verse — (Various Artists)
A Star Is Born — Lady Gaga & Bradley Cooper

Best Score Soundtrack For Visual Media:

Avengers: Endgame — Alan Silvestri, composer
Chernobyl — Hildur Guðnadóttir, composer
Game Of Thrones: Season 8 — Ramin Djawadi, composer
The Lion King — Hans Zimmer, composer
Mary Poppins Returns — Marc Shaiman, composer

Best Song Written For Visual Media:

“The Ballad Of The Lonesome Cowboy” — Randy Newman, songwriter (Chris Stapleton); Track from: “Toy Story 4”
“Girl In The Movies” — Dolly Parton & Linda Perry, songwriters (Dolly Parton); Track from: “Dumplin’”
“I’ll Never Love Again (Film Version)” — Natalie Hemby, Lady Gaga, Hillary Lindsey & Aaron Raitiere, songwriters (Lady Gaga & Bradley Cooper); Track from: A Star Is Born
“Spirit” — Beyoncé Knowles-Carter, Timothy McKenzie & Ilya Salmanzadeh, songwriters (Beyoncé); Track from: “The Lion King”
“Suspirium” — Thom Yorke, songwriter (Thom Yorke); Track from: “Suspiria”

COMPOSING/ARRANGING

Best Instrumental Composition:

“Begin Again” — Fred Hersch, composer (Fred Hersch & The WDR Big Band Conducted By Vince Mendoza)
“Crucible For Crisis” — Brian Lynch, composer (Brian Lynch Big Band)
“Love, A Beautiful Force” — Vince Mendoza, composer (Vince Mendoza, Terell Stafford, Dick Oatts & Temple University Studio Orchestra)
“Star Wars: Galaxy’s Edge Symphonic Suite” — John Williams, composer (John Williams)
“Walkin’ Funny” — Christian McBride, composer (Christian McBride)

Best Arrangement, Instrumental or A Cappella:

“Blue Skies” — Kris Bowers, arranger (Kris Bowers)
“Hedwig’s Theme” — John Williams, arranger (Anne-Sophie Mutter & John Williams)
“La Novena” — Emilio Solla, arranger (Emilio Solla Tango Jazz Orchestra)
“Love, A Beautiful Force” — Vince Mendoza, arranger (Vince Mendoza, Terell Stafford, Dick Oatts & Temple University Studio Orchestra)
“Moon River” — Jacob Collier, arranger (Jacob Collier)

Best Arrangement, Instruments and Vocals:

“All Night Long” — Jacob Collier, arranger (Jacob Collier Featuring Jules Buckley, Take 6 & Metropole Orkest)
“Jolene” — Geoff Keezer, arranger (Sara Gazarek)
“Marry Me A Little” — Cyrille Aimée & Diego Figueiredo, arrangers (Cyrille Aimée)
“Over The Rainbow” — Vince Mendoza, arranger (Trisha Yearwood)
“12 Little Spells (Thoracic Spine)” — Esperanza Spalding, arranger (Esperanza Spalding)

PACKAGE

Best Recording Package:

Anónimas & Resilientes — Luisa María Arango, Carlos Dussan, Manuel García-Orozco & Juliana Jaramillo-Buenaventura, art directors (Voces Del Bullerengue)
Chris Cornell — Barry Ament, Jeff Ament, Jeff Fura & Joe Spix, art directors (Chris Cornell)
Hold That Tiger — Andrew Wong & Fongming Yang, art directors (The Muddy Basin Ramblers)
i,i — Aaron Anderson & Eric Timothy Carlson, art directors (Bon Iver)
Intellexual — Irwan Awalludin, art director (Intellexual)

Best Boxed or Special Limited Edition Package:

Anima — Stanley Donwood & Tchocky, art directors (Thom Yorke)
Gold In Brass Age — Amanda Chiu, Mark Farrow & David Gray, art directors (David Gray)
1963: New Directions — Josh Cheuse, art director (John Coltrane)
The Radio Recordings 1939–1945 — Marek Polewski, art director (Wilhelm Furtwängler & Berliner Philharmoniker)
Woodstock: Back To The Garden – The Definitive 50th Anniversary Archive — Masaki Koike, art director (Various Artists)

NOTES

Best Album Notes:

The Complete Cuban Jam Sessions — Judy Cantor-Navas, album notes writer (Various Artists)
The Gospel According To Malaco — Robert Marovich, album notes writer (Various Artists)
Pedal Steel + Four Corners — Brendan Greaves, album notes writer (Terry Allen And The Panhandle Mystery Band)
Pete Seeger: The Smithsonian Folkways Collection — Jeff Place, album notes writer (Pete Seeger)
Stax ’68: A Memphis Story — Steve Greenberg, album notes writer (Various Artists)

HISTORICAL

Best Historical Album:

The Girl From Chickasaw County – The Complete Capitol Masters — Andrew Batt & Kris Maher, compilation producers; Simon Gibson, mastering engineer (Bobbie Gentry)
The Great Comeback: Horowitz At Carnegie Hall — Robert Russ, compilation producer; Andreas K. Meyer & Jennifer Nulsen, mastering engineers (Vladimir Horowitz)
Kankyo Ongaku: Japanese Ambient, Environmental & New Age Music 1980-1990 — Spencer Doran, Yosuke Kitazawa, Douglas Macgowan & Matt Sullivan, compilation producers; John Baldwin, mastering engineer (Various Artists)
Pete Seeger: The Smithsonian Folkways Collection — Jeff Place & Robert Santelli, compilation producers; Pete Reiniger, mastering engineer (Pete Seeger)
Woodstock: Back To The Garden – The Definitive 50th Anniversary Archive — Brian Kehew, Steve Woolard & Andy Zax, compilation producers; Dave Schultz, mastering engineer, Brian Kehew, restoration engineer (Various Artists)

PRODUCTION, NON-CLASSICAL

Best Engineered Album, Non-Classical:

All These Things — Tchad Blake, Adam Greenspan & Rodney Shearer, engineers; Bernie Grundman, mastering engineer (Thomas Dybdahl)
Ella Mai — Chris “Shaggy” Ascher, Jaycen Joshua & David Pizzimenti, engineers; Chris Athens, mastering engineer (Ella Mai)
Run Home Slow — Paul Butler & Sam Teskey, engineers; Joe Carra, mastering engineer (The Teskey Brothers)
Scenery — Tom Elmhirst, Ben Kane & Jeremy Most, engineers; Bob Ludwig, mastering engineer (Emily King)
When We All Fall Asleep, Where Do We Go? — Rob Kinelski & Finneas O’Connell, engineers; John Greenham, mastering engineer (Billie Eilish)

Producer Of The Year, Non-Classical:

Jack Antonoff
Dan Auerbach
John Hill
Finneas
Ricky Reed

Best Remixed Recording:

“I Rise (Tracy Young’s Pride Intro Radio Remix)” — Tracy Young, remixer (Madonna)
“Mother’s Daughter (Wuki Remix)” — Wuki, remixer (Miley Cyrus)
“The One (High Contrast Remix)”– Lincoln Barrett, remixer (Jorja Smith)
“Swim (Ford. Remix)” — Luc Bradford, remixer (Mild Minds)
“Work It (Soulwax Remix)” — David Gerard C Dewaele & Stephen Antoine C Dewaele, remixers (Marie Davidson)

PRODUCTION, IMMERSIVE AUDIO

Best Immersive Audio Album:

Chain Tripping — Luke Argilla, immersive audio engineer; Jurgen Scharpf, immersive audio mastering engineer; Jona Bechtolt, Claire L. Evans & Rob Kieswetter, immersive audio producers (Yacht)
Kverndokk: Symphonic Dances — Jim Anderson, immersive audio engineer; Robert C. Ludwig, immersive audio mastering engineer; Ulrike Schwarz, immersive audio producer (Ken-David Masur & Stavanger Symphony Orchestra)
Lux — Morten Lindberg, immersive audio engineer; Morten Lindberg, immersive audio mastering engineer; Morten Lindberg, immersive audio producer (Anita Brevik, Trondheimsolistene & Nidarosdomens Jentekor)
The Orchestral Organ — Keith O. Johnson, immersive audio engineer; Keith O. Johnson, immersive audio mastering engineer; Marina A. Ledin & Victor Ledin, immersive audio producers (Jan Kraybill)
The Savior — Bob Clearmountain, immersive audio engineer; Bob Ludwig, immersive audio mastering engineer; Michael Marquart & Dave Way, immersive audio producers (A Bad Think)

PRODUCTION, CLASSICAL

Best Engineered Album, Classical:

Aequa – Anna Thorvaldsdóttir — Daniel Shores, engineer; Daniel Shores, mastering engineer (International Contemporary Ensemble)
Bruckner: Symphony No. 9 — Mark Donahue, engineer; Mark Donahue, mastering engineer (Manfred Honeck & Pittsburgh Symphony Orchestra)
Rachmaninoff – Hermitage Piano Trio — Keith O. Johnson & Sean Royce Martin, engineers; Keith O. Johnson, mastering engineer (Hermitage Piano Trio)
Riley: Sun Rings — Leslie Ann Jones, engineer; Robert C. Ludwig, mastering engineer (Kronos Quartet)
Wolfe: Fire In My Mouth — Bob Hanlon & Lawrence Rock, engineers; Ian Good & Lawrence Rock, mastering engineers (Jaap Van Zweden, Francisco J. Núñez, Donald Nally, The Crossing, Young People’s Chorus Of NY City & New York Philharmonic)

Producer Of The Year, Classical:

Blanton Alspaugh
James Ginsburg
Marina A. Ledin, Victor Ledin
Morten Lindberg
Dirk Sobotka

CLASSICAL

Best Orchestral Performance:

“Bruckner: Symphony No. 9” — Manfred Honeck, conductor (Pittsburgh Symphony Orchestra)
“Copland: Billy The Kid; Grohg” — Leonard Slatkin, conductor (Detroit Symphony Orchestra)
“Norman: Sustain” — Gustavo Dudamel, conductor (Los Angeles Philharmonic)
“Transatlantic” — Louis Langrée, conductor (Cincinnati Symphony Orchestra)
“Weinberg: Symphonies Nos. 2 & 21” — Mirga Gražinyt?-tyla, conductor (City Of Birmingham Symphony Orchestra & Kremerata Baltica)

Best Opera Recording:

“Benjamin: Lessons In Love & Violence” — George Benjamin, conductor; Stéphane Degout, Barbara Hannigan, Peter Hoare & Gyula Orendt; James Whitbourn, producer (Orchestra Of The Royal Opera House)
“Berg: Wozzeck” — Marc Albrecht, conductor; Christopher Maltman & Eva-Maria Westbroek; François Roussillon, producer (Netherlands Philharmonic Orchestra; Chorus Of Dutch National Opera)
“Charpentier: Les Arts Florissants; Les Plaisirs De Versailles” — Paul O’Dette & Stephen Stubbs, conductors; Jesse Blumberg, Teresa Wakim & Virginia Warnken; Renate Wolter-Seevers, producer (Boston Early Music Festival Chamber Ensemble; Boston Early Music Festival Vocal Ensemble)
“Picker: Fantastic Mr. Fox” — Gil Rose, conductor; John Brancy, Andrew Craig Brown, Gabriel Preisser, Krista River & Edwin Vega; Gil Rose, producer (Boston Modern Orchestra Project; Boston Children’s Chorus)
“Wagner: Lohengrin” — Christian Thielemann, conductor; Piotr Becza?a, Anja Harteros, Tomasz Konieczny, Waltraud Meier & Georg Zeppenfeld; Eckhard Glauche, producer (Festspielorchester Bayreuth; Festspielchor Bayreuth)

Best Choral Performance:

“Boyle: Voyages” — Donald Nally, conductor (The Crossing)
“Duruflé: Complete Choral Works” — Robert Simpson, conductor (Ken Cowan; Houston Chamber Choir)
“The Hope Of Loving” — Craig Hella Johnson, conductor (Conspirare)
“Sander: The Divine Liturgy Of St. John Chrysostom” — Peter Jermihov, conductor (Evan Bravos, Vadim Gan, Kevin Keys, Glenn Miller & Daniel Shirley; PaTRAM Institute Singers)
“Smith, K.: The Arc In The Sky” — Donald Nally, conductor (The Crossing)

Best Chamber Music/Small Ensemble Performance:

“Cerrone: The Pieces That Fall To Earth” — Christopher Rountree & Wild Up
“Freedom & Faith” — Publiquartet
“Perpetulum” — Third Coast Percussion
“Rachmaninoff” – Hermitage Piano Trio — Hermitage Piano Trio
“Shaw: Orange” — Attacca Quartet

Best Classical Instrumental Solo:

“The Berlin Recital” — Yuja Wang
“Higdon: Harp Concerto” — Yolanda Kondonassis; Ward Stare, conductor (The Rochester Philharmonic Orchestra)
“Marsalis: Violin Concerto; Fiddle Dance Suite” — Nicola Benedetti; Cristian M?celaru, conductor (Philadelphia Orchestra)
“The Orchestral Organ” — Jan Kraybill
“Torke: Sky, Concerto For Violin” — Tessa Lark; David Alan Miller, conductor (Albany Symphony)

Best Classical Solo Vocal Album:

The Edge Of Silence – Works For Voice By György Kurtág — Susan Narucki (Donald Berman, Curtis Macomber, Kathryn Schulmeister & Nicholas Tolle)
Himmelsmusik — Philippe Jaroussky & Céline Scheen; Christina Pluhar, conductor; L’arpeggiata, ensemble (Jesús Rodil & Dingle Yandell)
Schumann: Liederkreis Op. 24, Kerner-lieder Op. 35 — Matthias Goerne; Leif Ove Andsnes, accompanist
Songplay — Joyce Didonato; Chuck Israels, Jimmy Madison, Charlie Porter & Craig Terry, accompanists (Steve Barnett & Lautaro Greco)
A Te, O Cara — Stephen Costello; Constantine Orbelian, conductor (Kaunas City Symphony Orchestra)

Best Classical Compendium:

American Originals 1918 — John Morris Russell, conductor; Elaine Martone, producer
Leshnoff: Symphony No. 4 ‘heichalos’; Guitar Concerto; Starburst — Giancarlo Guerrero, conductor; Tim Handley, producer
Meltzer: Songs And Structures — Paul Appleby & Natalia Katyukova; Silas Brown & Harold Meltzer, producers
The Poetry Of Places — Nadia Shpachenko; Marina A. Ledin & Victor Ledin, producers
Saariaho: True Fire; Trans; Ciel D’hiver — Hannu Lintu, conductor; Laura Heikinheimo, producer

Best Contemporary Classical Composition:

Bermel: Migration Series For Jazz Ensemble & Orchestra – Derek Bermel, composer (Derek Bermel, Ted Nash, David Alan Miller, Juilliard Jazz Orchestra & Albany Symphony Orchestra)
Higdon: Harp Concerto – Jennifer Higdon, composer (Yolanda Kondonassis, Ward Stare & The Rochester Philharmonic Orchestra)
Marsalis: Violin Concerto In D Major – Wynton Marsalis, composer (Nicola Benedetti, Cristian M?celaru & Philadelphia Orchestra)
Norman: Sustain – Andrew Norman, composer (Gustavo Dudamel & Los Angeles Philharmonic)
Shaw: Orange – Caroline Shaw, composer (Attacca Quartet)
Wolfe: Fire In My Mouth – Julia Wolfe, composer (Jaap Van Zweden, Francisco J. Núñez, Donald Nally, The Crossing, Young People’s Chorus Of NY City & New York Philharmonic)

MUSIC VIDEO/FILM

Best Music Video:

We’ve Got To Try – The Chemical Brothers, Ellie Fry, video director; Ninian Doff, video producer
This Land – Gary Clark Jr., Savanah Leaf, video director; Alicia Martinez, video producer
Cellophane – FKA twigs, Andrew Thomas Huang, video director; Alex Chamberlain, video producer
Old Town Road (Official Movie)” — Lil Nas X & Billy Ray Cyrus, Calmatic, video director; Candice Dragonas, Melissa Larsen & Saul Levitz, video producers
Glad He’s Gone – Tove Lo, Vania Heymann & Gal Muggia, video directors; Natan Schottenfels, video producer

Best Music Film:

HOMECOMING – Beyoncé, Beyoncé Knowles-Carter & Ed Burke, video directors; Dora Melissa Vargas, video producer
Remember My Name – David Crosby, A.J. Eaton, video director; Cameron Crowe, Michele Farinola & Greg Mariotti, video producers
Birth Of The Cool – Miles Davis, Stanley Nelson, video director; Nicole London, video producer
Shangri-la – Various Artists,Morgan Neville, video director; Emma Baiada, video producer
Anima – Thom Yorke, Paul Thomas Anderson, video director; Paul Thomas Anderson, Erica Frauman & Sara Murphy, video producers.

 

 

Tags: daftarlengkapgrammygrammygrammy2020grammyaward2020SAI100FM
Previous Post

Duet Kimo dan Joko Anwar di Ratu Ilmu Hitam Raih 400 Ribu Penonton dalam 5 Hari

Next Post

Hai, your raisa! Raisa Akan Gelar Konser di GBK

Next Post

Hai, your raisa! Raisa Akan Gelar Konser di GBK

Saikustik/ Cannot Play- Cross Time

Kania Adhisty - Kita Yang Dulu

SAIKUSTIK With Rama/ Arah

Petra Sihombing Gandeng Sheryl Sheinafia di Single Terbaru Bertajuk 'Astrology'

  • Beranda
  • Hubungi Kami
  • NEWS
  • Privacy Policy
  • Profil
  • Radio SAI
  • Stream

© 2023 - SAI100FM.ID

No Result
View All Result
  • BERANDA
  • HIBURAN
  • MUSIK
  • FILM
  • K-POP
  • GAYA HIDUP
  • KESEHATAN
  • SOSOK
  • TEKNOLOGI
  • NEWS
  • PROFIL
  • HUBUNGI KAMI

© 2023 - SAI100FM.ID

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In
prettyskin kombucha first essence 150ml picomonte galactomyces sheet mask 35 pcs growus damage therapy no wash treatment ex 250ml the saem cover perfection tip concealer 1 25 light beige 4ea set a pieu juicy pang jelly blusher 4 8g rd01 apple 1ea vl01 grape 1ea set isntree hyaluronic acid aqua gel cream 100ml kumano cosme horse oil hair cream 160g laneige cica sleeping mask 60ml 1ea 10ml 3ea set clio kill cover skin fixer cushion spf50 pa refill only 15g esthetic house esthetic formula collagen massage cream 300ml make p rem x haruharu wonder x bellflower skincare set esfolio pure skin sweet strawberry hand cream 100ml medicube toner pad special set 765g dariya salon de pro hair color cream 1box 3 bright light brown 2ea set nivea japan rich care color lip coral red 2g benton snail bee ultimate eye cream 30g 1ea serum 35ml 1ea set stridex alcohol free sensitive pads with aloe green 55pcs 2ea set scinic enjoy super active airy sun stick spf50 pa 15g 8ea set aplb bakuchiol propolis ampoule serum 40ml ilso moringa tightening pore serum 30ml kumano cosme pharmaact tonic rinse in shampoo 550ml haruharu wonder black rice probiotics barrier essence milky essence 120ml 2ea set orbis aquanist rich moist moisture 50ml skin1004 madagascar centella hyalu cica blue serum 30ml 3ea set la mer the eye balm intense 15ml daeng gi meo ri honey intensive hair mask 150ml a pieu juicy pang water blusher 9g pk04 grapefruits 4ea set stylevana advent calendar 2023 elizavecca milky piggy 24k gold snail foam cleansing so natural all day tight make up setting fixx 35ml prettyskin design your beauty damage care argan treatment 500ml dove lux bath glow repair shine shampoo refill 350g vt vita light brightening set purederm clean bright oxygen bubble mask 3 5ml 3 5ml peach rohto mentholatum skin aqua uv super moisture gel hydrating sunscreen 10ea set prettyskin essential hyaluronic mask sheet 1pc anua green lemon vita c belmish serum mask 1pc shiseido water in lip medicinal stick nf n natural care fragrance free color free 3 5g cos de baha peptide cream pc 45ml 4ea set the ordinary the ordinary squalane cleanser 50ml 4ea set miseenscéne damage care red protein condition 680ml dermafirm hydra cleanser r4 perilla purple 150g holika holika aloe hydro formula 96 soothing gel 55ml 2ea set kracie hadabisei eye bags smooth serum 25g kao biore ouchi de esthe makeup remover massage black gel 200g dr forhair unove deep damage repair shampoo 500g isntree yam root vegan milk cream 80ml the saem natural mask sheet buffet set a matsuyama m mark amino acid soap shampoo 600ml neogen dermalogy dermalogy white truffle serum in oil drop 50ml